PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT30658
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family Dof
Protein Properties Length: 205aa    MW: 20775.4 Da    PI: 10.5269
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT30658genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof703.7e-2238732762
    zf-Dof 27 sqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                Pr+fCkaC+ryWt+GG+lrnvPvGgg+rknk+s+
  EMT30658 38 GAPRHFCKACKRYWTRGGTLRNVPVGGGCRKNKRSR 73
              57*******************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088415.3231771IPR003851Zinc finger, Dof-type
ProDomPD0074783.0E-93662IPR003851Zinc finger, Dof-type
PfamPF027011.2E-163971IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
MAGAAGGLLR LRWCSQPPLL ARGGAARSRP EPVAVALGAP RHFCKACKRY WTRGGTLRNV  60
PVGGGCRKNK RSRSSNGSGG RPGSCAVVAS SNAAAGGIAS STSMSLPPPG SLSSALGLHG  120
HGSSSLASLL LGSGASGGDH LGLFHAMQSV VSDATAYEMH QQHQTQVDQL LGLGYGAGDA  180
NGSQIHIKPW QQHLQDGAGG LFDGF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3689790.0AK368979.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2083D03.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002460750.14e-45hypothetical protein SORBIDRAFT_02g034320
TrEMBLM8C9761e-144M8C976_AEGTA; Dof zinc finger protein
STRINGMLOC_21982.11e-85(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88953041
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.23e-12Dof family protein